PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.J9WH5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 375aa    MW: 42546.3 Da    PI: 7.7222
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.J9WH5genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.99.4e-5491381129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPtdeel+++yLkkkv+ +k+++ +vi+evd++k+ePwdL++  ++ +  ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk + + 
  Araip.J9WH5   9 VPPGFRFHPTDEELLHYYLKKKVSFQKFDM-DVIREVDLNKMEPWDLQErcRIGStPQNEWYFFSHKDRKYPTGSRTNRATNAGFWKATGRDKCIRN- 104
                  69****************************.99**************963433332556*************************************9. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                  + +++g++ktLvfykgrap+g+ktdW+mheyrle
  Araip.J9WH5 105 TYKKIGMRKTLVFYKGRAPHGQKTDWIMHEYRLE 138
                  8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-608160IPR003441NAC domain
PROSITE profilePS5100558.279160IPR003441NAC domain
PfamPF023655.4E-2810137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MGSSNNGGVP PGFRFHPTDE ELLHYYLKKK VSFQKFDMDV IREVDLNKME PWDLQERCRI  60
GSTPQNEWYF FSHKDRKYPT GSRTNRATNA GFWKATGRDK CIRNTYKKIG MRKTLVFYKG  120
RAPHGQKTDW IMHEYRLEDS NDPQANANED GWVVCRVFKK KNLFKIGNEG GGGSTHTSSD  180
QQLNNSTATN ARSFMQRENH YLLQNPRNGN PSSSSSGFDE LDKPELGLHH YPHMQTPHYS  240
LFHHSQPLLH PQAHKPIVYD YSYAPALPSD PPVIAKQLMT NPRDCDSGGS EGLRYQQVSE  300
PGMEVGSCEQ AQEMGAARGG GEGMNEWGVL DRLVTGNLGN EDSANKGIRF EDANPHQINQ  360
LSLRGEMDFW GYGKQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-51916217167NO APICAL MERISTEM PROTEIN
1ut4_B1e-51916217167NO APICAL MERISTEM PROTEIN
1ut7_A1e-51916217167NO APICAL MERISTEM PROTEIN
1ut7_B1e-51916217167NO APICAL MERISTEM PROTEIN
4dul_A1e-51916217167NAC domain-containing protein 19
4dul_B1e-51916217167NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016193261.10.0PREDICTED: protein BEARSKIN2-like
SwissprotQ9SV871e-159BRN2_ARATH; Protein BEARSKIN2
TrEMBLA0A0B2RJF10.0A0A0B2RJF1_GLYSO; Protein BEARSKIN1
TrEMBLI1LNQ40.0I1LNQ4_SOYBN; Uncharacterized protein
STRINGGLYMA12G00540.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87523343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-155NAC domain containing protein 70